2.63 Rating by CuteStat

free-instant-website-audit.com is 2 decades 5 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, free-instant-website-audit.com is SAFE to browse.

PageSpeed Score
58
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 9
Google Adsense: Not Applicable Google Analytics: UA-32647203-1

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

Grandfamilies

- cssgrandfamilies.org
Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 03 Jun 2017 10:32:45 GMT
Server: Apache
Last-Modified: Mon, 29 May 2017 17:42:59 GMT
ETag: "1f8d-550ad37ceb040"
Accept-Ranges: bytes
Content-Length: 8077
Content-Type: text/html

Domain Information

Domain Registrar: PacNames Ltd
Registration Date: Apr 9, 1999, 12:00 AM 2 decades 5 years 1 week ago
Last Modified: Feb 20, 2017, 12:00 AM 7 years 1 month 3 weeks ago
Expiration Date: Apr 9, 2018, 12:00 AM 6 years 5 days 18 hours ago
Domain Status:
clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
free-instant-website-audit.com A 14399 IP: 184.175.95.2
free-instant-website-audit.com NS 86399 Target: ns3.hostek.com
free-instant-website-audit.com NS 86399 Target: ns4.hostek.com
free-instant-website-audit.com SOA 86399 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2017052904
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
free-instant-website-audit.com MX 14399 Target: free-instant-website-audit.com
free-instant-website-audit.com TXT 14399 TXT: v=spf1 +a +mx +ip4:184.175.95.2 ~all